PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr027642.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 475aa    MW: 52883 Da    PI: 6.4432
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr027642.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS464.17.8e-142494711374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lLl+cA++v++g+le+a+ +L+++s+la+ dgd+mqR+aayfteALa r+++ +++l +al++++ s   +s+e+ ++k+f+e+ P+lk++++++
  Pbr027642.1  49 LIHLLLTCANHVATGSLENANVALEQISQLAAADGDTMQRIAAYFTEALADRILKAWPGLHRALNSTKIS--LVSDEILVRKVFFEMLPFLKVAFVLT 144
                  689*************************************************************999998..7************************* PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  NqaI+ea+ege++vHiiD+++ +++QW++Llq L++Rpegpp+lRiTgv++    +ke l ++++rL++ Ae+l++pf+f + + ++le+l++++Lrv
  Pbr027642.1 145 NQAIMEAMEGEKMVHIIDLNAAEPVQWITLLQVLSARPEGPPHLRITGVHQ----RKEVLDQMAHRLTEEAEKLDIPFQFCP-IISKLENLDMDKLRV 237
                  ***************************************************....9**************************.7999*********** PP

         GRAS 197 kpgEalaVnlvlqlhrll......................................................desvsles..erdevLklvkslsPkv 238
                  k+gEala+++vlqlh+ll                                                      ++++sl+   + d++L+++++l Pkv
  Pbr027642.1 238 KTGEALAISSVLQLHSLLasddgllkkksplasrgsngnhlpralqmsqgtlgellekemgngyspspdstsSSPLSLTPsaKLDSFLNAFWGLTPKV 335
                  ********************************************************************999855555544457899************ PP

         GRAS 239 vvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakq 336
                  +v++eq+++hn+++++er+le+l+ y+alfd+le++++r+s er kvE++l+g+ei+n++aceg+er+erhe+lekW +rl+ aGF++vpls++ + q
  Pbr027642.1 336 MVITEQDSNHNGSTLMERLLESLYSYAALFDCLESTMSRTSLERLKVEKMLFGKEIKNIIACEGSERTERHEKLEKWIQRLDLAGFGNVPLSYYGMLQ 433
                  ************************************************************************************************** PP

         GRAS 337 aklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ak++l+ ++ dgyr+ ee+g++++ W+drpL+svSaWr
  Pbr027642.1 434 AKRMLQSYGCDGYRMREENGCVLISWQDRPLFSVSAWR 471
                  *************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.39423451IPR005202Transcription factor GRAS
PfamPF035142.7E-13949471IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MAPMFQDEGS SSATSSPLQC FSMISLSPSL GSPYPWLKEL KSEDRGLYLI HLLLTCANHV  60
ATGSLENANV ALEQISQLAA ADGDTMQRIA AYFTEALADR ILKAWPGLHR ALNSTKISLV  120
SDEILVRKVF FEMLPFLKVA FVLTNQAIME AMEGEKMVHI IDLNAAEPVQ WITLLQVLSA  180
RPEGPPHLRI TGVHQRKEVL DQMAHRLTEE AEKLDIPFQF CPIISKLENL DMDKLRVKTG  240
EALAISSVLQ LHSLLASDDG LLKKKSPLAS RGSNGNHLPR ALQMSQGTLG ELLEKEMGNG  300
YSPSPDSTSS SPLSLTPSAK LDSFLNAFWG LTPKVMVITE QDSNHNGSTL MERLLESLYS  360
YAALFDCLES TMSRTSLERL KVEKMLFGKE IKNIIACEGS ERTERHEKLE KWIQRLDLAG  420
FGNVPLSYYG MLQAKRMLQS YGCDGYRMRE ENGCVLISWQ DRPLFSVSAW RCRK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-45494714375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009337039.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLM5WFN20.0M5WFN2_PRUPE; Uncharacterized protein
STRINGVIT_06s0009g02390.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23833484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3